Where results make sense

About us   |   Why use us?   |   Reviews   |   PR   |   Contact us

Topic: Deinococcus-Thermus

    Note: these results are not from the primary (high quality) database.

Thermus For many high-temperature strains of Thermus, nitrate is used as a terminal electron acceptor and Themus grows anaerobically in the presence (but not in the absence) of it. Thermus strains use several substrates for growth, including carbohydrates, amino acids, carboxylic acids, and peptides (R. Huber et al. Thermus is assumed to have a pilus-like structure, though the molecular basis of the DNA uptake is still unknown. biology.kenyon.edu /Microbial_Biorealm/bacteria/thermus/thermus.htm

outlinee.htm The 16S rRNA genes of Aquifex, Bacillus, Deinococcus, Thermus and Thermus ruber The 16S rRNA genes of Aquifex, Bacillus, Deinococcus and Thermus Estimated value of proportion of invariable sites = 0.228318 www.dbbm.fiocruz.br /james/lecture5/outlinee.htm

BioMed Central Full text The single-stranded DNA-binding protein of Deinococcus radiodurans Meima R, Lidstrom ME: Characterization of the minimal replicon of a cryptic Deinococcus radiodurans SARK plasmid and development of versatile Escherichia coli-D.radiodurans shuttle vectors. The correct sequence reveals a longer and completely contiguous ORF for ssb, encoding an SSB protein closely related to the recently characterized Thermus thermophilus and Thermus aquaticus SSB proteins [ 7 ]. The correct Deinococcus radiodurans ssb gene is a contiguous open reading frame that codes for the largest bacterial SSB monomer identified to date. www.biomedcentral.com /1471-2180/4/2

deinococcus Thermus aquaticus, found in hot springs in Yellowstone National Park, is the source of the Taq DNA polymerase, the enzyme that makes the PCR reaction possible. Deinococcus exhibits resistance to DNA damage by very high levels of radiation and mutagenic chemicals. Members of this small, unique group are among the most resistant living things. comenius.susqu.edu /bi/202/EUBACTERIA/FIRMICUTAE/deinococcobacteria.htm

Deinococcus radiodurans :: Online Encyclopedia :: Information Genius Deinococcus radiodurans is an extremophile, and the most radiation -resistant organism known. Deinococcus radiodurans :: Online Encyclopedia :: Information Genius Currently 8 species are classified in genus Deinococcus, all of them extremophiles. www.informationgenius.com /encyclopedia/d/de/deinococcus_radiodurans.html

Thermus aquaticus - Wikipedia, the free encyclopedia It is one of several thermophilic bacteria that belong to the Deinococcus-Thermus group. DNA polymerase was first isolated from Thermus aquaticus in 1976. Note: The term "Taq" to refer to Thermus aquaticus arose from the convention of giving restriction enzymes short names such as Sal and Hin, names that come from the genus and species names of the source organisms. en.wikipedia.org /wiki/Thermus_aquaticus

Larry Wackett's Homepage This website displays information on the taxonomic tree going from a phylum, the Thermus Deinococcus group to the genus Deinocccus and the species radiodurans. Structural analysis of DNA repair proteins in Deinococcus radiodurans It is part of the High-quality Automated Microbial Annotation of Proteomes (HAMAP) section of ExPASy. biosci.cbs.umn.edu /labs/wackett/wacweb/linkshtm/d-radioduran.html

chlamydiales pallidum Thermotogales-Thermotoga_maritima Thermus /Deinococcus group-Deinococcus radiodurans Planctomyces/ Chlamydia /Verrucomicrobium group- Chlamydia_trachomatis - Chlamydia_muridarum freesense.free.fr /Bacteria/c/28.htm

Thermus thermophilus tmRNA, version 2 Taxonomy: Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae; Thermus thermophilus ; strains HB8 (nominally same strain as for version 1) and HB27 Possible intraspecies variation; the equally reliable version 1 has the differing base: 310A. www.indiana.edu /~tmrna/seqs/Therm.ther2.html

Crystal structure of the Deinococcus radiodurans single-stranded DNA-binding protein suggests a mechanism for coping with DNA damage -- Bernstein et al., 10.1073/pnas.0401331101 -- Proceedings of the National Academy of Sciences -hairpin structure that is unique to Deinococcus and Thermus Crystal structure of the Deinococcus radiodurans single-stranded DNA-binding protein suggests a mechanism for coping with DNA damage -- Bernstein et al., 10.1073/pnas.0401331101 -- Proceedings of the National Academy of Sciences Crystal structure of the Deinococcus radiodurans single-stranded DNA-binding protein suggests a mechanism for coping with DNA damage www.pnas.org /cgi/content/abstract/0401331101v1

Disruption analysis of DR1420 and/or DR1758 in the extremely radioresistant bacterium Deinococcus radiodurans -- Nishida and Narumi 148 (9): 2911 -- Microbiology Keywords: Deinococcus radiodurans, Thermus thermophilus, lysine biosynthesis, gene disruption, evolution Disruption analysis of DR1420 and/or DR1758 in the extremely radioresistant bacterium Deinococcus radiodurans Makarova, K. S., Aravind, L., Wolf, Y. I., Tatusov, R. L., Minton, K. W., Koonin, E. and Daly, M. Genome of the extremely radiation-resistant bacterium Deinococcus radiodurans viewed from the perspective of comparative genomics. mic.sgmjournals.org /cgi/content/full/148/9/2911

Closely Related CC- and A-adding Enzymes Collaborate to Construct and Repair the 3'-Terminal CCA of tRNA in Synechocystis sp. and Deinococcus radiodurans -- Tomita and Weiner 277 (50): 48192 -- Journal of Biological Chemistry and Deinococcus radiodurans -- Tomita and Weiner 277 (50): 48192 -- Journal of Biological Chemistry A-adding polypeptide; Tm, Thermatoga maritima CCA-adding enzyme; DR.1, Deinococcus radiodurans CC-adding polypeptide; DR.2, D. These data indicate that the Synechocystis Sy.S and Deinococcus DR.1 polypeptides are most closely related to A. www.jbc.org /cgi/content/full/277/50/48192

New Page 1 These species together form a distinct eubacterial phylogenetic lineage, believed to be most closely related to the Thermus genus, and it has been proposed that Deinococcus and Thermus form a eubacterial phylum [Woese et al., 1987; Weisberg et al., 1989; Woese et al., 1992; Narumi et al., 1996; Rainey et al., 1997]. Deinococcus radiodurans ( strain R1) was the first of the deinobacteria to be discovered and was isolated in Oregon in 1956 [Anderson et al., 1956] from X-ray sterilized canned meat that had spoiled. Despite ubiquitous distribution and ancient derivation, only seven species of the family Deinococcaceae have been described [Minton, 1996; Ferreira et al., 1997]. www.usuhs.mil /pat/deinococcus/FrontPage_DR_Web_work/Pages/Deinococcaceae/Deinoc.htm

SWISSPROT: SYFA_THETH OC Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae; OC Thermus. RC STRAIN=HB8 / ATCC 27634; RX MEDLINE= 92375722 ; PubMed= 1508711 ; RA Kreutzer R., Kruft V., Bobkova E.V., Lavrik O.J., Sprinzl M.; RT "Structure of the phenylalanyl-tRNA synthetase genes from Thermus RT thermophilus HB8 and their expression in Escherichia coli."; RL Nucleic Acids Res. OX NCBI_TaxID=274; RN [1] RP SEQUENCE FROM N.A. ; PubMed= 1451792 ; DOI=10.1016/0014-5793(92)80215-3; RA Keller B., Kast P., Hennecke H.; RT "Cloning and sequence analysis of the phenylalanyl-tRNA synthetase RT genes (pheST) from Thermus thermophilus."; RL FEBS Lett. pbil.univ-lyon1.fr /cgi-bin/acnuc-search-ac?query=P27001&db=SWISSPROT

Molecular Analyses of the Natural Transformation Machinery and Identification of Pilus Structures in the Extremely Thermophilic Bacterium Thermus thermophilus Strain HB27 -- Friedrich et al. 68 (2): 745 -- Applied and Environmental Microbiology machinery in Thermus might be due to the structural distinctiveness The genes of the pil competence locus in Thermus, comprising Similarity searches within the Thermus genomic database with aem.asm.org /cgi/content/full/68/2/745

Firm but Slippery Attachment of Deinococcus geothermalis -- Kolari et al. 184 (9): 2473 -- The Journal of Bacteriology two Deinococcus species seem to share the ability to form tenacious Genome of the extremely radiation-resistant bacterium Deinococcus radiodurans viewed from the perspective of comparative genomics. We recently showed Deinococcus geothermalis to be an efficient intl-jb.asm.org /cgi/content/full/184/9/2473

Distinctive Protein Signatures Provide Molecular Markers and Evidence for the Monophyletic Nature of the Deinococcus-Thermus Phylum -- Griffiths and Gupta 186 (10): 3097 -- The Journal of Bacteriology genera within this phylum, viz., Deinococcus, Thermus, and Meiothermus, and all such fragments (except SerRS in Deinococcus proteolyticus) support a sister group relationship between the Thermus and jb.asm.org /cgi/content/abstract/186/10/3097

Deinococcus radiodurans Using genetic engineering Deinococcus has been given the abilities to consume and digest solvent s and heavy metals, even in a highly radioactive site. The term Deinobacter has been replaced by Deinococcus based on evaluation of ribosomal RNA sequences. Deinococcus radiodurans (former Micrococcus radiodurans) is an extremophilic bacterium, and is the most radiation -resistant organism known. www.mcfly.org /wik/Deinococcus_radiodurans

Lecture 10 Thermus aquaticus is the source of Taq polymerase used in PCR - since the Thermus DNA polymerase is thermostable, it survives the denaturation step and doesn't have to be added in each round, allowing automation of the procedure. A dramatic demonstration of the ability of Deinococcus to repair its DNA are these direct optical images of DNA from Deinococcus under going repair following massive irradiation that breaks the DNA up into small fragments. What are the ramifications of this for both the mother and daughter cells, compared to binary fission? www.mbio.ncsu.edu /JWB/MB409/lecture/lecture10/lecture10.html

ipedia.com: Deinococcus-Thermus Article The two classes are deinococcus and thermus, resistant to radiation and heat respectively. Starware search is an excellent resource for quality sites on deinococcus thermus and much more! Deinococcus-Thermus Scientific classification Domain : Bacteria Division: Deinococcus-Thermus Classes Deinococcus · Deinococcales · Deinococcus radiodurans Thermus · Thermales &mi... www.ipedia.com /deinococcus_thermus.html

t2.html ssu rRNA-targeted oligonucleotide probes for members of Crenarchaeota and of the bacterial Genera Deinococcus, Thermus and Meiothermus www.bode.cs.tum.edu /~meierh/downloads/hicomb_probes/t2.html

Genome of the Extremely Radiation-Resistant Bacterium Deinococcus radiodurans Viewed from the Perspective of Comparative Genomics -- Makarova et al. 65 (1): 44 -- Microbiology and Molecular Biology Reviews The prominence of the "eukaryotic" component of the signal transduction systems in Deinococcus is underscored by the fact Furthermore, in addition to the intact GatB, Deinococcus encodes operon and probably have been acquired by Deinococcus through mmbr.asm.org /cgi/content/full/65/1/44

Fatty acid biosynthesis in Mycobacterium tuberculosis: Lateral gene transfer, adaptive evolution, and gene duplication -- Kinsella et al. 100 (18): 10320 -- Proceedings of the National Academy of Sciences of a separate clade with Bacillus halodurans and Deinococcus Therefore in this first step of the pathway, we www.pnas.org /cgi/content/full/100/18/10320

Sequencing of heat shock protein 70 (DnaK) homologs from Deinococcus proteolyticus and Thermomicrobium roseum and their integration in a protein-based phylogeny of prokaryotes -- Gupta et al. 179 (2): 345 -- The Journal of Bacteriology Sequencing of heat shock protein 70 (DnaK) homologs from Deinococcus proteolyticus and Thermomicrobium roseum and their integration in a protein-based phylogeny of prokaryotes -- Gupta et al. well as Thermus aquaticus contained a large insert in the N- terminal Sequencing of heat shock protein 70 (DnaK) homologs from Deinococcus proteolyticus and Thermomicrobium roseum and their integration in a protein-based phylogeny of prokaryotes jb.asm.org /cgi/content/abstract/179/2/345

Protein Phylogenies and Signature Sequences: A Reappraisal of Evolutionary Relationships among Archaebacteria, Eubacteria, and Eukaryotes -- Gupta 62 (4): 1435 -- Microbiology and Molecular Biology Reviews Signature Sequences Indicating that Deinococcus and Thermus Are Intermediates in the Transition from Gram-Positive to Gram-Negative Bacteria Signature Sequence Distinguishing between Low-G+C and High-G+C Gram-Positive Bacteria and Pointing to a Specific Relationship of the Latter Group to the Gram-Negative Bacteria mmbr.asm.org /cgi/content/full/62/4/1435

gdr36orf2.6.aln Methanococcus ----- Methanobacterium ----- Pyrococcus ----- Archaeoglobus ----- Bombyx TSV-- Homo ETIEE C.elegans ----- Schizosaccharomyces ----- Saccharomyces ETD-- Arabidopsis ----- Aeropyrum ----- Deinococcus ----- Thermus ----- Mycobacterium ----- Treponema ----- Borrelia ----- Mycoplasma ----- M.pneumoniae ----- *:.* * : Methanococcus KNNIISKFREQYIIK--EGFYEIESPTVTPYEVLKASGHVDNFTDPIVECKNCLESFRAD Methanobacterium KNKIMNRWREFYVVR--EGFYEIESPTIMPEEALKASGHVDHFNDPMTQCKECMDVYRAD Pyrococcus KRKIEKKIREAFIR---EGFFEIETPDITPEQVFIASGHVEKFVDPIVECKKCGARFRAD Archaeoglobus RRKIENIWRKYFVIN--ERAAEIDTPTIGIEEVFIASGHATSFTDVAIECENCGRVYRAD Bombyx KSNMIHLWKKFFILQ--EQMLEVECSILTPEPVLKASGHVERFADLMTKDIKTGECFRLD Homo KNNIIQTWRQHFIQE--EQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRAD C.elegans KANMLQEWRKHFILE--EGMLEVDCTSLTPEPVLKASGHVDRFADWMVKDMKNGECFRAD Schizosaccharomyces QSNLVDIWRKHFVIE--ESMLEVDCSMLTPHEVLKTSGHVDKFADWMCKDPATGEIFRAD Saccharomyces QNNIIDAWRKHFILE--EDMLEVDCTMLTPYEVLKTSGHVDKFSDWMCRDLKTGEIFRAD Arabidopsis KSNVLSFWRQHFILE--ENMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRAD Aeropyrum KRRIIEKWRRYFVLMHQDHVVEIETPVIGPEKVYIASGHVEHFTDPIVRCTSCGRTFRAD Deinococcus KNNIKAAWWRSNVYER-DDMEGLDASIIMHRMVLRHSGHEATFSDPMIDNKKNNKRYRLD Thermus KNNLKQAWWRRNVYER-DDMEGLDASVLTHRLVLHYSGHEATFADPMVDNRITKKRYRLD Mycobacterium KENIKRQWWRSVVTGR-DDVVGIDSSIILPREVWVASGHVDVFHDPLVESLITHKRYRAD Treponema KNNIAHAWWQDMTRLH-DHIVGLDAAILMHPNVWRTSGHVDHFSDPLVDCTVCKSRFRAD Borrelia KKNIKKEWWKSMVYLH-ENIVGLDSAIFMRPEIWRASGHVDGFSDSMVDCKDCKSRFRAD Mycoplasma KQQIKQALYNFFIKNK-ADVLLVETPIILSELVWKASGHLANFVDTLVDCKSCKYRFRVD M.pneumoniae KQQIKTALYNFFIKNK-RDVLLIDTPIILNEQIWKASGHLANFTDALVDCKSCKLRFRVD :.:. carrot.mcb.uconn.edu /hgtpaper/table1/gdr36_orf2.6/gdr36orf2.6.aln

Dynamically generated Blast Output of job Strep_blastx_vs_nr AMINOPEPTIDASE T pirJN0087 leucyl aminopeptidase T - Thermus aquaticus dbjBAA00695.1 AMINOPEPTIDASE T pirJC5862 leucyl aminopeptidase Th - Thermus aquaticus dbjBAA02654.1 aminopeptidase - Deinococcus radiodurans gbAAF11738.1AE002052_1 aminopeptidase [Deinococcus radiodurans] www.biol.ucl.ac.be /gene/genome/root/html/C104_gm_0003.htm

ipedia.com: Deinococcus-Thermus Article The two classes are deinococcus and thermus, resistant to radiation and heat respectively. Deinococcus-Thermus Scientific classification Domain : Bacteria Division: Deinococcus-Thermus Classes Deinococcus · Deinococcales · Deinococcus radiodurans Thermus · Thermales &mi... Deinococcus radiodurans became famous for its ability to eat nuclear waste and toxic metals, to survive in the vacuum of space and to survive extremes of heat and cold. www.ipedia.com /deinococcus_thermus.html   (145 words)

BioMed Central Full text The single-stranded DNA-binding protein of Deinococcus radiodurans radiodurans SSB protein is consistent with and reinforces the close phylogenetic relationship between Deinococcus and bacteria of the Thermus group of extremophiles [2,4-6]. Deinococcus radiodurans R1 is one of the most radiation-resistant organisms known and is able to repair an unusually large amount of DNA damage without induced mutation. Deinococcus radiodurans R1, a tetrad-forming gram positive soil bacterium, is among the most radiation resistant organisms known [1]. www.biomedcentral.com /1471-2180/4/2   (5564 words)

Encyclopedia article on Deinococcus-Thermus [EncycloZine] The Deinococcus-Thermus are a small group of bacteria comprises cocci that are highly resistant to environmental hazards. The Deinococcales include a single genus, Deinococcus, with several species that are resistant to radiation; they have become famous for their ability to eat nuclear waste and other toxic materials, survive in the vacuum of space and survive extremes of heat and cold. The Thermales include several genera resistant to heat. encyclozine.com /Deinococcus-Thermus   (5564 words)

Try your search on: Qwika (all wikis)

About us   |   Why use us?   |   Reviews   |   Press   |   Contact us   Copyright © 2005-2007 www.factbites.com Usage implies agreement with terms.