Factbites
 Where results make sense
About us   |   Why use us?   |   Reviews   |   PR   |   Contact us  

Topic: FV 432 AFV


Related Topics

In the News (Wed 10 Feb 10)

  
  Sony Kv 27fv17
The FV 432 AFV is one of the British Army's FV 430 series of armoured fighting vehicles, and the most common variant used for transporting infantry on the battlefield.
The FV 432 Series are being replaced by FV 510 Warriors.
The following is a (partial) listing of FV numbers ("fighting vehicle") as used by the British Army.
www.breadlike.com /pages7/81/sony-kv-27fv17.html   (843 words)

  
 Armed Forces - a5a11 - British Army - The Infantry - AFV 103 Spartan
Fv 101 Scorpion, Fv 102 Striker, Fv 104 Samaritan, Fv 105 Sultan, Fv 106 Sampson and Fv 107 Scimitar.
Samaritan, Sultan and Sampson are also APC type vehicles, Samaritan is the CVRT ambulance vehicle, Sultan is the armoured command vehicle and Sampson is an armoured recovery vehicle.
Spartan, like FV 432 is likely to be replaced in some roles by the future Multi Role Armoured Vehicle (MRAV) and in other roles by the Future Command and Liaison Vehicle (FCLV).
www.armedforces.co.uk /army/listings/l0037.html   (202 words)

  
 [No title]
FV 301 Light tank armed with a 77mm gun FV 302 Gun Position Officer/Command Post Vehicle FV 303 20 pdr SP Anti-tank gun FV 304 25 pdr SPG FV 305 5.5 in.
Both the FV 421 and the FV 423 are pictured in the Profile.
The FV 438 was originally a Swingfire launcher but was subsequently converted into a Royal Signals Wavell vehicle when Swingfire was withdrawn.
apma.org.au /thinktank/thinktank0095.txt   (2129 words)

  
 DGA
My first experience with a tracked AFV was driving my own Stuart Light Tank and although there is a world of difference between an APC and a Stuart, the basic handling is the same.
They are noisy without being deafening and fit the image of an AFV power plant, however, the manual does call for a minimum hearing protection of a headset or helmet and states that ear plugs should also be worn.
The majority of most AFV crews (except all drivers and the gunners in MBTs) spend their career riding their vehicles standing up, not sitting as you would expect.
www.trackpads.net /sites/heavymetal/oper01.html   (2569 words)

  
 Global Defence Review   (Site not responding. Last check: 2007-10-03)
The principal programme milestones are assessment phase: May 2003-Dec 2005; main gate: Dec 2005; ISD: 2009.The FRES is the UK programme to deliver a family of deployable medium-weight armoured vehicles to the British Army, to meet up to 15 different battle space roles.
There are four key drivers: delivery of a cost-effective rapid effect capability; elimination of Saxon, CVR (T) and FV 432 from the UK inventory; increased levels of commonality across the UK light AFV fleet; war fighting capability and utility across the conflict spectrum.
The statement of user need for FRES is: "The user requires a system of medium land forces able to conduct sustained, expeditionary, full spectrum operations in combined-arms, joint and multi-national contexts, in a wide range of future operating environments".
www.global-defence.com /2006/Utilities/article.php?id=27   (1586 words)

  
 [No title]
As I understand, that was the point of the bradly, an AFV that is light enough to be air-mobile, but still carries some armor and AT capabilities to handle itself untill the tanks arrive.
I said the job of fighting and the job of carrying infantry should be seperated to different AFVs.
Also as you mentioned, a heavily armored but lightly armed APC is also likely to be much cheaper than an IFV and will have moe room for the infantry.
www.strategypage.com /militaryforums/2-16813.aspx   (2662 words)

  
 Tanknet > Anybody else see that AFV collector?
One of the collectors was a Texan who has his own fleet of over 30 AFVs and other military vehicles.
Ive not heard anything about this in any of the British miltary vehicle magazines.Besides, I cant see how the Police could do it, not only in many cases are they obsolete ammunition and therefore exempt, but it would mean cutting up a lot of museum pieces.
I really have no idea what the laws are on driving tracked AFVs on the road in the States, but I'd guess they differ from one jurisdiction to another.
www.tank-net.org /forums/lofiversion/index.php/t13741.html   (1810 words)

  
 missing-lynx.com - articles
In the field, AFV crews use this method to raise roadwheels up off the track surfaces so that they may be replaced.
Most photos of Gulf war AFV’s do not show the level of wear I have depicted.
One thing about an AFV with all those side bins is that it probably would not have a lot of external stowage.
www.missing-lynx.com /articles/modern/gdwar/gdwar.htm   (4634 words)

  
 Wireless for the Warrior. Larkspur Harness 'B' (via CobWeb/3.1 planetlab2.cs.unc.edu)   (Site not responding. Last check: 2007-10-03)
This harness was principally for the control of one or two sets, very flexible, variable in content and layout, and at the time the most common harness in use.
The Junction Box Three Set 'J3', was developed exclusively for use in the Armoured Personnel Carrier FV 432, which enables three sets to work in one harness using standard Wireless Control Harness type 'B' components.
A second Junction Box Three Set 'J3' was normally fitted at the rear of the vehicle, enabling the Infantry commander to stand at the rear of the APC and still retain all his communication facilities.
home.hccnet.nl.cob-web.org:8888 /l.meulstee/harnessb1/harnessb1.html   (3985 words)

  
 Ten Rounds Rapid - Modern
The distances that AFV’s can move are based on their cross country speed.
When moving in poor or bad terrain, or trying to cross a linear obstacle such as a hedge fence or wall units and individual roll terrain penalties.
The values are as far as possible compatible with those in the companion WW 2 set although some have been reduce by a point or two.
www.freewargamesrules.co.uk /Rules/Modern/basicsmod.html   (3884 words)

  
 Armed Forces - a5a10 - British Army - The Infantry - MCV 80 Fv 510 (Warrior)
Warrior is an armoured infantry fighting vehicle (AIFV) that replaced the AFV 432 in the armoured infantry battalions.
Current thinking suggests that the British Army may replace existing rifle platoon Warrior with the improved Warrior 2000.
This would release existing Warrior to be refitted to fulfil roles currently carried out by ageing and obsolescent FV 432s.
www.armedforces.co.uk /army/listings/l0036.html   (482 words)

  
 Armed Forces - a5a09 - British Army - The Infantry - AFV 432 (via CobWeb/3.1 planetlab2.cs.unc.edu)   (Site not responding. Last check: 2007-10-03)
Armed Forces - a5a09 - British Army - The Infantry - AFV 432 (via CobWeb/3.1 planetlab2.cs.unc.edu)
The FV 430 family of vehicles is rapidly approaching the end of its service life.
There are currently three funded vehicle programmes which will replace role vehicles currently provided by the 430 series. 
www.armedforces.co.uk.cob-web.org:8888 /army/listings/l0035.html   (245 words)

  
 DGA (via CobWeb/3.1 planetlab2.cs.unc.edu)   (Site not responding. Last check: 2007-10-03)
The vehicles on display on the day I was there were an M60, an FV 432, a HVSS Sherman, a T-59, a Jagdpanzer and 2 Ferret Mk2's (one live one dead).
Normally a Chieftain is used, but the M60 had to run in it's place as the British Army had borrowed the Chieftain, quite why I don't know.
One interesting part of the design is the large single piece engine hatch; this is raised by inserting a handle into a jacking mechanism at the rear of the vehicle.
www.users.zetnet.co.uk.cob-web.org:8888 /lsm/dhmg/bovingto.html   (1660 words)

  
 [No title]
> >For the benefit of readers unfamiliar with 1/200 scale, the first AFV and >vehicle ranges were done by Wiking in Germany and Pilot in Denmark in the >mid-1930's.
The Wikings became the standard training and You may be the answer to a search I've been on.
I know the conversion kit was not widely used, but I understand that at least recovery 432 was used on Salisbury Plain, and on that particular vehicle the earth spade was carried on the vehicle front.
apma.org.au /thinktank/thinktank0003.txt   (1898 words)

  
 Daimler Ferret Mk 1/2, 1963 - Aldershot Military Museum
It is powered by a Rolls Royce B60 engine and its maximum speed is 93 kph (60 mph).
The Ferret has further developed into the Fox AFV.
It was armed with either a Bren Light Machine Gun, a GPMG or a.30 Browning MG.
www.hants.gov.uk /museum/aldershot/collections/ferret.html   (137 words)

  
 DGA
From Chris in England comes the following article on one of the several operators who provide a supervised AFV driving experience.
The majority were on a "on demand" basis and despite the advertising didn't include an actual tank, most were APC's such as Fv 432's or Fv 434's.
I did contact Tanks-A-Lot and was given their schedule for the summer months, unfortunately the only date they were active in July was 3 days after we left England.
www.users.zetnet.co.uk /lsm/dhmg/milcham2.html   (645 words)

  
 Modern AFV Discussion Group
Posts that violate the guidelines or Terms and conditions of Use of the Missing-lynx.com discussion groups will be erased, and repeated violation of this policy may result in termination of the violator's account.
The Modern AFV discussion group is hosted by Graeme Davidson and Erik Gustavsson and covers the variety of AFVs used by all nations in the post WWII era.
FV 432 Book - Bob Griffin on Feb 26, 3:10 AM
www.network54.com /Forum/47209/page-167   (2766 words)

  
 Tanknet > British infantry section
Im afraid I have to disagree the 84 man in my experience carried an SLR/L1A1and I have never seen the section GPMG used as a pintle mounted weapon on a FV 432.
The L37 could be reverted back to the ground role if needed (the Butt and Barrel were always issued with the weapon).
Had a crew of 2, with 8 in the back, so assuming commander debused with the rest of the section.
www.tank-net.org /forums/lofiversion/index.php/t9440.html   (5849 words)

  
 New Armoured Vehicles for British Army - Military Photos
Having just listened to defence questions, it appears that – contrary to my earlier report - the MoD is NOT buying RG-31s.
Defence secretary Des Browne announced he was sending 70 up-armoured FV 432s, and 100 "Cougars", procured "through US military sources".
My confusion about the "Cougars" arises from the fact that the name is used informally for the RG-31s and the price range cited would not have covered the larger vehicle also used by the US Marine Corps, also called the Cougar, used by bomb disposal officers.
www.militaryphotos.net /forums/showthread.php?t=86920   (2231 words)

  
 British Army Rumour Service > > Forums > > Infantry   (Site not responding. Last check: 2007-10-03)
Am I right in hearing that instead of binning the obsolete 432 we are going to modernise it?
I wonder how long before there are any spare parts in the system...
Your AFV fleet is at risk unless you keep up repayments.
www.arrse.co.uk /cpgn2/Forums/viewtopic/t=33995.html   (639 words)

  
 Andre's russian 1:72/1:76 scale AFV page   (Site not responding. Last check: 2007-10-03)
APC FV 425 Missile Launcher, 1:72 Atlantic 606
APC FV 432 with GPMG Turret, 1:76 Cromwell Models CM21
MICV FV 510 Warrior up-armoured (Gulf War), 1:76 Cromwell Models CM54
www.smallafv.nn.ru /katalog_nato.html   (862 words)

  
 FV 432 - Aldershot Military Museum
It is rugged and reliable but the lack of vision for the driver and crew was a drawback.
It has now been replaced by the Warrior AFV, which was introduced in 1987.
Hampshire County Council, The Castle, Winchester, Hampshire, SO23 8UJ
www.hants.gov.uk /museum/aldershot/collections/fv.html   (86 words)

  
 SPARE PARTS FROM MARCUS GLENN
NATO batteries - lead acid, 2 year guarantee - special offer £58.00 + VAT
B series ignition coil FV 141532 no:1 MK 2
Selection of lubricants available from stock to keep your vehicles running
www.marcusglenn.com /spares.htm   (183 words)

  
 [No title]
ribosomal protein S1 [Chlorobium tepidum TLS] Length = 550 Score = 35.8 bits (81), Expect = 1.5 Identities = 15/35 (42%), Positives = 24/35 (67%) Query: 249 DIKVGMVADALVRNITDRAAFVEVNGISGRMKLNE 283 +IKVGMV + V+NITD FV++ G+ G + + + Sbjct: 179 NIKVGMVLEGTVKNITDFGIFVDLGGLDGLVHITD 213 >gi23005827gbZP_00048451.1
S1 ribosomal protein [Escherichia coli] Length = 556 Score = 33.1 bits (74), Expect = 9.4 Identities = 15/53 (28%), Positives = 29/53 (54%) Query: 249 DIKVGMVADALVRNITDRAAFVEVNGISGRMKLNECNSINTKYVRGVVYKVDE 301 +++ GM +V+N+TD AFV++ G+ G + + + K+ +V DE Sbjct: 187 NLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDE 239 >gi16121672refNP_404985.1
ribosomal protein S1 fragment (1135 is 1st base in codon) [Providencia sp.] Length = 378 Score = 33.1 bits (74), Expect = 9.4 Identities = 15/53 (28%), Positives = 29/53 (54%) Query: 249 DIKVGMVADALVRNITDRAAFVEVNGISGRMKLNECNSINTKYVRGVVYKVDE 301 +++ GM +V+N+TD AFV++ G+ G + + + K+ +V DE Sbjct: 83 NLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDE 135 >gi42837embCAA23630.1
jbpc.mbl.edu /Nosema/Contigs/txtfiles/contig_25_6876.txt   (1091 words)

  
 [No title]
hypothetical protein [Macaca fascicularis] Length = 218 Score = 43.9 bits (102), Expect = 0.003 Identities = 22/58 (37%), Positives = 34/58 (57%) Query: 267 KLVVKNVPFQADAQELRKLFQTKAQVKAVRIPVKRNKQSRGFAFVECASREDAQKILE 324 ++ V + F+ + +LRK F VK V+I R S+G+ FV ++EDAQKIL+ Sbjct: 34 RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQ 91 >gi15221187refNP_177563.1
unnamed protein product [Homo sapiens] Length = 339 Score = 43.9 bits (102), Expect = 0.003 Identities = 22/58 (37%), Positives = 34/58 (57%) Query: 267 KLVVKNVPFQADAQELRKLFQTKAQVKAVRIPVKRNKQSRGFAFVECASREDAQKILE 324 ++ V + F+ + +LRK F VK V+I R S+G+ FV ++EDAQKIL+ Sbjct: 40 RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQ 97 >gi14719414refNP_149019.1
bol, boule-like (Drosophila) [Homo sapiens] Length = 283 Score = 43.9 bits (102), Expect = 0.003 Identities = 22/58 (37%), Positives = 34/58 (57%) Query: 267 KLVVKNVPFQADAQELRKLFQTKAQVKAVRIPVKRNKQSRGFAFVECASREDAQKILE 324 ++ V + F+ + +LRK F VK V+I R S+G+ FV ++EDAQKIL+ Sbjct: 34 RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQ 91 >gi15233670refNP_192644.1
jbpc.mbl.edu /Nosema/Contigs/txtfiles/contig_93_1741.txt   (1746 words)

Try your search on: Qwika (all wikis)

Factbites
  About us   |   Why use us?   |   Reviews   |   Press   |   Contact us  
Copyright © 2005-2007 www.factbites.com Usage implies agreement with terms.