
	Where results make sense

Topic: Methanopyrus

Related Topics

Methanogen

Hyperthermophile

Archaea

Mesophile

In the News (Thu 24 Dec 09)

Northern Trust

Marvin Harrison

Peter Chernin

Gary Locke

Match Play

Penelope Cruz

Mickey Rourke

AR Rahman

Danny Boyle

Hugh Jackman

	The phylogeny of Methanopyrus kandleri -- Rivera and Lake 46 (1): 348 -- International Journal of Systematic and ...
		The phylogeny of Methanopyrus kandleri -- Rivera and Lake 46 (1): 348 -- International Journal of Systematic and Evolutionary Microbiology
		Methanopyrus, we determined the sequence of an informative region of
		Methanopyrus diverged from the eocyte branch before the eukaryotic and
	ijs.sgmjournals.org /cgi/content/abstract/46/1/348 (324 words)

	Methanopyrus - MicrobeWiki
		Methanopyrus kandleri Copyright K.O.Stetter and R.Rachel, Univ. Regensburg, Germany
		Methanopyrus kandleri has been located at the base of a 2,000 m deep "fl smoker" chimney on the sea floor in the Gulf of California.
		The complete genome of hyperthermophile Methanopyrus kandleri AV19 and monophyly of archaeal methanogens.
	microbewiki.kenyon.edu /mediawiki-1.6.6/index.php/Methanopyrus (199 words)

	Identification, cloning and characterization of a new DNA-binding protein from the hyperthermophilic methanogen ...
		Identification, cloning and characterization of a new DNA-binding protein from the hyperthermophilic methanogen Methanopyrus kandleri -- Pavlov et al.
		11 Kurr,M., Huber,R., König,H., Jannasch,H.W., Fricke,H., Trincone,A., Kristjansson,J.K. and Stetter,K.O. Methanopyrus kandleri, gen. and sp.
		18 Slesarev,A.I., Lake,J.A., Stetter,K.O., Gellert,M. and Kozyavkin,S.A. (1994) Purification and characterization of DNA topoisomerase V. An enzyme from the hyperthermophilic prokaryote Methanopyrus kandleri that resembles eukaryotic topoisomerase I. Biol.
	nar.oxfordjournals.org /cgi/content/full/30/3/685 (5845 words)

	[No title] (Site not responding. Last check: 2007-11-06)
		Calcineurin superfamily phosphatase (nuclease) with Zn-cluster [Methanopyrus kandleri AV19] MLDVTRLPGDRLLISSDIHVGDEYQGHDRETWEAALDLARDFDAFLIDGDLADPRASDPELRELLRDLRE LSSEVPTYFVPGNHDTVDLVKSLRDAGVHVLSRRYDNRRGRGCPPGHSGPSLGGPHLLRFGDAWMLVLHG HEPCSELGLNPQKPVNPVARESPMPKRDQILDNYTCREYEMPDRLEEIARSTHADVVITGHTHCRYLGSL EGKLVVNVGTTSCPAICATCRDPLNVGNVCILKASGGTLRAKLFNLRKARVIGRERVRIGRR >MK0123 gi19886410gbAAM01340.1
		Uncharacterized protein [Methanopyrus kandleri AV19] MGRAPVLVYRGAGHVALHVVRGGAAAGWGIVHAGEPVTIIPGVVAEE >MK0314 gi19886657gbAAM01531.1
		Uncharacterized protein [Methanopyrus kandleri AV19] MRLWRLTAVMRLRNVMSRLVLALKEVEGGIIVGLLYDSN >MK0369 gi19886729gbAAM01586.1
	www.cs.bgu.ac.il /~nomsiew/ORFans/SinOlists/SinO_Mkand.list (3214 words)

	E0152: Mad Structure Determination of a Histone from the Hyperthermophile Methanopyrus Kandeleri (Site not responding. Last check: 2007-11-06)
		MAD Structure Determination of a Histone from the Hyperthermophile Methanopyrus kandeleri.
		We are determining the crystal structure of a histone (MkaH) from the hyperthermophile Methanopyrus kandeleri.
		We are therefor examining the possibilities of non-crystallographic symmetry coincident with a symmetry axis, twinning, or a super-cell to explain the high R factor.
	www.hwi.buffalo.edu /ACA/ACA98/abstracts/text/E0152.html (220 words)

	An ancestral nuclear protein assembly: Crystal structure of the Methanopyrus kandleri histone -- Fahrner et al. 10 ...
		An ancestral nuclear protein assembly: Crystal structure of the Methanopyrus kandleri histone -- Fahrner et al.
		DNA-binding, we infer that the Methanopyrus histone binds DNA
		When the Methanopyrus histone protein gene was isolated (Slesarev et al.
	www.proteinscience.org /cgi/content/full/10/10/2002 (2750 words)

	Crystal structures and enzymatic properties of three formyltransferases from archaea: Environmental adaptation and ...
		Shima, S., Weiss, D.S., and Thauer, R.K. Formylmethanofuran:tetrahydromethanopterin formyltransferase (Ftr) from the hyperthermophilic Methanopyrus kandleri: Cloning, sequencing and functional expression of the ftr gene and one step purification of the enzyme overproduced in Escherichia coli.
		Activation and thermostabilization effects of cyclic 2,3-diphosphoglycerate on enzymes from the hyperthermophilic Methanopyrus kandleri.
		Lyotropic-salt-induced changes in monomer/dimer/tetramer association equilibrium of formyltransferase from the hyperthermophilic Methanopyrus kandleri in relation to the activity and thermostability of the enzyme.
	www.proteinscience.org /cgi/content/full/11/9/2168 (4795 words)

	On proteins, DNA and topology - Message Board - ezboard.com (Site not responding. Last check: 2007-11-06)
		Identification, cloning and characterization of a new DNA-binding protein from the hyperthermophilic methanogen Methanopyrus kandleri.
		Three novel DNA-binding proteins with apparent molecular masses of 7, 10 and 30 kDa have been isolated from the hyperthermophilic methanogen Methanopyrus kandleri.
		The proteins were identified using a blot overlay assay that was modified to emulate the high ionic strength intracellular environment of M.kandleri proteins.
	p205.ezboard.com /fmsdiagnosedfrm74.showPrevMessage?topicID=39.topic (793 words)

	SCOP: Search Results for 1e6v (Site not responding. Last check: 2007-11-06)
		Protein: Alpha chain from Archaeon Methanopyrus kandleri [a.89.1.1]
		Protein: Methyl-coenzyme M reductase gamma chain from Archaeon Methanopyrus kandleri [d.58.31.1]
		Protein: Alpha chain from Archaeon Methanopyrus kandleri [d.58.31.2]
	scop.berkeley.edu /search.cgi?pdb=1e6v;ver=1.69 (53 words)

	Archaeal Diversity Study Guide (Site not responding. Last check: 2007-11-06)
		cocci (1.5-2.5 µm) that occur in singlets (Methanococcus), aggregates (Methanolobus), packets (Methanosarcina), or chains (Methanopyrus)
		Strictly anaerobic, fastidious (require vitamins, amino acids, nickel {part of coenzyme F430, hydrogenase, carbon monoxide dehydrogenase}, iron, cobalt); Methanopyrus is an extreme thermophile; no known methanogens have a complete TCA cycle; some can fix nitrogen
		Methanopyrus - oxidizes hydrogen for energy (4 H
	www.cas.muohio.edu /~stevenjr/mbi630/archaea630.html (729 words)

	Methanopyrus Kurr et al
		Genera and taxa above the rank of genus up to and including class:
		[KURR (M.), HUBER (R.), KÖNIG (H.), JANNASCH (H.W.), FRICKE (H.), TRINCONE (A.), KRISTJANSSON (J.K.) and STETTER (K.O.): Methanopyrus kandleri, gen. and sp.
		The information on this page may not be reproduced, republished or mirrored on another webpage or website.
	www.bacterio.cict.fr /m/methanopyrus.html (204 words)

	Phylogeny of Methanopyrus kandleri based on methyl coenzyme M reductase operons -- Nolling et al. 46 (4): 1170 -- ...
		Phylogeny of Methanopyrus kandleri based on methyl coenzyme M reductase operons -- Nolling et al.
		Phylogeny of Methanopyrus kandleri based on methyl coenzyme M reductase operons
		J Nolling, A Elfner, JR Palmer, VJ Steigerwald, TD Pihl, JA Lake and JN Reeve
	ijs.sgmjournals.org /cgi/content/abstract/46/4/1170 (401 words)

	[No title]
		LOCUS AE009439 1694969 bp DNA circular CON 03-APR-2002 DEFINITION Methanopyrus kandleri AV19, complete genome.
		SOURCE Methanopyrus kandleri AV19 ORGANISM Methanopyrus kandleri AV19 Archaea; Euryarchaeota; Methanopyri; Methanopyrales; Methanopyraceae; Methanopyrus.
		REFERENCE 1 (bases 1 to 1694969) AUTHORS Slesarev,A.I., Mezhevaya,K.V., Makarova,K.S., Polushin,N.N., Shcherbinina,O.V., Shakhova,V.V., Belova,G.I., Aravind,L., Natale,D.A., Rogozin,I.B., Tatusov,R.L., Wolf,Y.I., Stetter,K.O., Malykh,A.G., Koonin,E.V. and Kozyavkin,S.A. TITLE The complete genome of hyperthermophile Methanopyrus kandleri AV19 and monophyly of archaeal methanogens JOURNAL Proc.
	www.cbs.dtu.dk /services/GenomeAtlas/Archaea/Methanopyrus/kandleri/AV19/Main/Mkandleri_AV19_Main.gbk (68 words)

	HGT-DB Methanopyrus kandleri AV19
		See the statistical parameters of all the genome.
		See the correspondence analysis of relative synonymous codon usages for Methanopyrus kandleri AV19 genes.
		See the extraneous regions in terms of G+C content.
	www.fut.es /~debb/HGT/mkand.d/welcome.html (52 words)

	The Diversity of Life (via CobWeb/3.1 planetlab1.cs.virginia.edu) (Site not responding. Last check: 2007-11-06)
		The methanogens are a phylogenetically diverse group, despite the fact that they share a common phenotype, namely they are strict anaerobes with the ability to chemically reduce carbon compounds to methane to provide energy.
		Associated with the methanogens is a phenotypically diverse group of organisms represented by such organism as Thermococcus celer, and Archaeoglobus fulgidus, and, possibly, Methanopyrus kandleri.
		This last organism grows at temperatures up to 112°C.
	genomics.ucla.edu.cob-web.org:8888 /eocyte/diverse.html (465 words)

	Class 12
		Compare the Methanopyrus sequence against the one from Arabidopsis.
		How many repeats do you identify when you compare the Methanopyrus sequence against itself?
		In vitro evolution has succeeded to evolving RNA's with novel properties, e.g.
	web.uconn.edu /gogarten/mcb221_2003/class12.html (385 words)

	UCLA Department of Molecular, Cell and Developmental Biology :: Home page of James Lake (Site not responding. Last check: 2007-11-06)
		Other recent evidence on the origin of eukaryotes from our lab have been the identification and characterization of an eukaryotic type I topoisomerase in a hyperthermophile, Methanopyrus, and the X-ray determination of a histone complex in Methanopyrus which has the structure of one-half of an eukaryotic nucleosome.
		Lake, J.A. Why Pauling didn't solve the structure of DNA.
		Fahrner, R.L., Cascio, D., Slesarev, A., Lake, J.A. A nucleosome Ancestor: Crystal Structure of the Histone from Methanopyrus kandleri.
	www.mcdb.ucla.edu /MCDBfacultyindiv.php?FacultyKey=710 (826 words)

	The complete genome of hyperthermophile Methanopyrus kandleri AV19 and monophyly of archaeal methanogens -- Slesarev et ...
		The complete genome of hyperthermophile Methanopyrus kandleri AV19 and monophyly of archaeal methanogens -- Slesarev et al.
		National Center for Biotechnology Information, National Library of Medicine, National Institutes of Health, Bethesda, MD 20894;
		We have determined the complete 1,694,969-nt sequence of the GC-rich genome of Methanopyrus kandleri by using a whole direct
	www.pnas.org /cgi/content/abstract/99/7/4644 (1317 words)

	SCOP: Search Results for 1gpj (Site not responding. Last check: 2007-11-06)
		Protein: Glutamyl tRNA-reductase dimerization domain from Archaeon Methanopyrus kandleri [a.151.1.1]
		Protein: Glutamyl tRNA-reductase middle domain from Archaeon Methanopyrus kandleri [c.2.1.7]
		Protein: Glutamyl tRNA-reductase catalytic, N-terminal domain from Archaeon Methanopyrus kandleri [d.58.39.1]
	scop.berkeley.edu /search.cgi?pdb=1gpj;ver=1.69 (41 words)

	HGT-DB Methanopyrus kandleri AV19
		Proposed horizontally transferred genes for Methanopyrus kandleri AV19 (See the Abbreviations used):
		Predicted RNA-binding protein containing PIN domain, a fragment
		Permease subunit of a ABC-type transport system involved in lipoprotein release
	www.fut.es /~debb/HGT/mkand.d/HGTList.html (363 words)

Try your search on: Qwika (all wikis)