
	Where results make sense

Topic: Waverly, Florida

Related Topics

Copper Canyon, Texas

Five Points, Ohio

William McCrea (politician)

San Salvador, El Salvador

In the News (Wed 23 Dec 09)

Northern Trust

Marvin Harrison

Peter Chernin

Gary Locke

Match Play

Penelope Cruz

Mickey Rourke

AR Rahman

Danny Boyle

Hugh Jackman

	Waverly - Wikipedia, the free encyclopedia
		Waverly is an English female given name meaning "quaking aspen".
		Waverly Fairgrounds, home of the Elizabeth Resolutes of the National Association, baseball's first major league, in 1873
		Waverly Hills Sanatorium, an old hospital in Louisville, Kentucky
	en.wikipedia.org /wiki/Waverly (141 words)

	Waverly Florist $34.95 \| Flower Delivery Waverly (FL) \| Florists in Waverly, Florida
		The population of Waverly is approximately 2,071 (1990).
		Waverly is positioned 27.96 degrees north of the equator and 81.61 degrees west of the prime meridian.
		Our Waverly, Florida florist directory is provided through a strategic partnership with Regional Direct.com, which has established partnerships with the most reliable, customer service-driven area Waverly florist and florists in Florida, including Waverly, Florida.
	www.albanywebsites.com /ex/asp/city.Waverly-Florida-Florist-FL/CityId.7676/xe/florists-flower-delivery.htm (159 words)

	Florida Personal Injury Lawyer- Cities: Wabasso - Worthington Springs
		When you live in Florida, you live in an unique area.
		Please be advised that Weitz and Luxenberg may not be able to represent every lawsuit in every area of Florida due to state and federal statutes.
		If we are unable to represent you, we may refer you to an attorney with whom we have a professional association, or to your state bar association for legal help.
	www.weitzlux.com /personalinjurylawyer/fl/florida_154784.html (319 words)

	Home Fashions: Waverly
		Signature Waverly designs such as Tahiti, with its beguiling palm tree motif, and La Frutta with its luscious hand-painted fruits, are offered in a wide range of products to refresh the kitchen and dining room because the collection includes table linens, hand-painted ceramic dinnerware and glassware, not to mention cheerful kitchen towels and oven mitts.
		Inspired by the beauty found in nature, Waverly Garden Room consists of a wide variety of delightful floral patterns, as well as complementary plaids, stripes and gingham checks.
		Waverly is not currently producing any dinnerware patterns at this time.
	www.microwavecookingforone.com /Waverly/index.html (564 words)

	Waverly Drug Rehab in Waverly, Florida, FL Drug Rehab Centers Drug Treatment Drug Rehabilitation Rehab Addiction ... (Site not responding. Last check: 2007-10-12)
		Crack cocaine is available throughout Florida and remains a drug of choice for many in the lower socio-economic areas of the state.
		Heroin is readily available throughout Florida, with the highest concentrations in the central and southern parts of the state.
		The labs in Florida tend to be small, quick cook labs, which produce an average of between 1 1/2 to 2 ounces of methamphetamine per batch.
	www.drugrehabresources.com /bycity.php/Florida/Waverly (8149 words)

	Waverly, Florida FL, profile (Polk County) - hotels, festivals, genealogy, newspapers - ePodunk
		Florida > All counties > Polk County > Waverly
		Waverly is in Polk County, in the Lakeland-Winter Haven metro area.
		Median rent in Waverly, at the time of the 2000 Census, was $236.
	www.epodunk.com /cgi-bin/genInfo.php?locIndex=8995 (680 words)

	The Waverly _ South Beach
		At The Waverly, you're at the center of it all.
		Choose from modern one and two bedroom residences with breathtaking bay, ocean or skyline views from your private balcony.
		The content and information displayed on this web site is the property of Florida SunBreak, Inc. and the downloading, reproduction or retransmission of images, virtual tours and text, other than for non-commercial individual use, is strictly prohibited.
	www.floridasunbreak.com /waverly_intro.htm (231 words)

	HESCO - Highland Exchange Service Cooperative
		Our administrative office and warehouse facility in Waverly is strategically located in the heart of central Florida.
		As a supply cooperative serving prominent Florida citrus producers, packers, and processors, it is HESCO's job to identify critical operating supply requirements of its members, negotiate favorable purchasing arrangements, and then order, receive, store and redistribute those supplies as needed.
		If you would like more detailed information on anything you see here, or on opening an account, please contact us and we'll be glad to respond to your questions or comments.
	www.hesco-fl.com (201 words)

	Waverly Medical Malpractice Lawyer: Free Legal Services in Florida (FL)
		If you have a loved one in Waverly who has a medical malpractice claim, click here to let them know about Weitz and Luxenberg.
		Please be advised that the firm may not be able to represent every lawsuit in all regions of Florida due to state and federal statutes.
		If we are unable to handle you legal claim, we may refer you to a lawyer with whom we have a relationship, or to your local bar for legal assistance.
	www.weitzlux.com /florida/waverlymedicalmalpracticelawyer_154819.html (327 words)

	Find Churches in Waverly Florida - FlockFinder.com
		A common thread amongst parents today is that they're looking for churches in Waverly Florida which pay special attention to childrens' needs.
		It's not difficult for parents to figure out that by having their children attend church, the core values and beliefs taught to them by churches in Waverly Florida will stay with them throughout their adult lives..
		This is why FlockFinder lets churches in Waverly Florida declare whether or not they have any security precautions in place for their childrens service.
	www.flockfinder.com /churches_florida/waverly/churches_waverly_florida.html (558 words)

	Waverly, FL Houses, Apartments, Cars, Mortgage Status, and Residents Info
		Back to: Waverly main page, Florida, Florida smaller cities, Florida small towns, All US cities.
		Median gross rent in Waverly, FL in 2000: $359
		Back to: Waverly, FL (don't miss, contains a wealth of additional information), Florida, All US cities.
	www.city-data.com /housing/houses-Waverly-Florida.html (348 words)

	Fruit Crate Art-Fruit Crate Labels-Famous Art Collector-FruitCrateArt.com
		Roe and sons, Winter Haven, Florida; William Roe, Blue Knight; Copyright 1932 by W.H.F.S. Corp., Moorish castle beyond the distant trees is approached by armored knight astride a rearing steed; full dressed warhorse includes rampant lion motif blanket; Schmidt Litho., San Francisco, California; 6 ¾ X 6 ¾ inches.
		FULL, Waverly Growers Cooperative, Waverly, Florida, Produce of U.S.A.; Orange, twig and leaf cartoon man is indeed full; large ripe ready to burst citrus fruit comprises his rotund body; 6 ¾ X 6 ¾ inches.
		MOONBEAM Seminole County Citrus Fruit, Nelson and Co., Oviedo, FLA, Florida; bright yellow full moon illuminates a thriving citrus orchard, palms wave in the distance; orange, grapefruit and tangerine logo 6 ¾ X 6 ¾.
	www.fruitcrateart.com /218.html (437 words)

	The Waverly South Beach Condominiums. The Waverly South Beach Waterfront and Oceanview luxury South Beach Condominiums ...
		The Waverly South Beach Waterfront and Oceanview luxury South Beach Condominiums and Residences at The Waverly, South Beach homes and real estate.
		The Waverly's exotic and tranquil Feng Shui Garden is a beautiful setting for a stroll, yoga-classes, or simply to...
		For correct representations, make reference to the documents required by section 718.503, Florida Statutes, to be furnished by the developer.
	www.jackiemarks.com /waverly.htm (597 words)

	Florida Pre Construction -Waverly Condos in Miami Beach (Site not responding. Last check: 2007-10-12)
		Florida Pre Construction -Waverly Condos in Miami Beach
		The Waverly - at South Beach is located directly between Biscayne Bay and The Atlantic Ocean, just two blocks from Lincoln Road, it offers easy access to great nightlife and trendy shopping and dining.
		Any unauthorized reproduction of any information without the permission of the developer may be subject to copyright infringement laws.
	www.floridarealtyfinder.com /Floridarealty_Miamibeach_Waverly.htm (216 words)

	Elegance in an oasis cradled by a park: South Florida Sun-Sentinel
		Yet the streets of Waverly Woods aren't quite lined with rows of cookie-cutter homes.
		Instead, the clusters of houses, townhouse and condos, cushioned by stretches of lush grass, are more of a Martha Stewart specialty: cool and classic, with a down-home feel.
		After construction is complete, Waverly Woods will be buffered with rows of trees.
	www.sun-sentinel.com /sports/bal-cp-waverlywoods,0,3726566.story?page=2 (263 words)

	The Governor and Cabinet - Florida Department of State
		The Bonds shall not constitute an obligation, either general or special, of the State or of any local government thereof; neither the State nor any local government thereof shall be liable thereon.
		Neither the full faith, revenue, credit nor taxing power of the State of Florida, or any local governments thereof shall be pledged to the payment of the principal of, premium (if any), or interest on the Bonds.
		The Bonds shall be payable as to principal, premium (if any), and interest solely out of revenues and other amounts pledged therefor.
	www.myflorida.com /myflorida/cabinet/agenda00/0509/agenda_sba.html (198 words)

	Waverly Adds Two New Collections To Its American Residences Home Decorating Fabric Collections: Woodland Retreat and ...
		Blend together South Florida’s lively mix of fun-loving Latin and Caribbean cultures, chic European influences, and a tropical landscape filled with exotic flora and fauna and you have the inspiration for Coconut Grove, one of the newest additions to Waverly’s American Residences program.
		The charming fabric designs beautifully capture the spirit of this sunny region with painterly patterns in a fresh, bright color palette that would be at home in any climate.
		As befits the casual South Florida lifestyle, most of the designs are printed on cotton duck with a soft hand and relaxed finish.
	www.waverly.com /New/ar_coconut.asp (209 words)

	Waverly singles - Waverly dating - Waverly personals (Site not responding. Last check: 2007-10-12)
		Waverly singles - Waverly dating - Waverly personals
		Search by State > Florida Singles Search by City > Waverly Singles
		In the arithmetic of love, one Waverly Portrait plus one click can equal the love of your life.
	www.match.com /love/florida/waverly.html (940 words)

	Waverly Surfside Condo Conversion FLOOR PLANS - Florida Real Estate: Aventura, Miami Beach, Key Biscayne, Sunny Isles ...
		Branon A. Edwards and Jelena Panfilova Edwards are licensed Florida real estate agents with Coldwell Banker Residential Real Estate, Incorporated with a primary office located on Crandon Blvd in Key Biscayne, Florida.
		The property information herein is derived from various sources that may include, but not be limited to, county records and the Multiple Listing Service.
		Although the information is believed to be accurate, it is not warranted, and you should not rely upon it without personal verification.
	www.investfloridarealty.com /preconstruction/waverly-floorplans.htm (375 words)

	Waverly Walk -- Profile (Site not responding. Last check: 2007-10-12)
		To date, Waverly has been a "straight A" student at the school.
		In the 2002-2003 school year, Waverly earned the lead role of the "Little Red Hen" in a play written by her teacher, Mrs.
		During the 2003-2004 school year, Waverly was the only Abercrombie Academy student that didn't miss a day of school AND wasn't tardy one of those days.
	www.walksports.com /waverlywalkprofile.htm (998 words)

	floridalabels
		Frostproof Florida, and it is “Truley” A work Of Art.
		A colorful framer, solid red background, with a pictorial Florida scene of packing plant.
		A good looking framer from Waverly Florida, pirate with ship in background.
	www.labelland.com /floridalabels.html (474 words)

	[No title] (Site not responding. Last check: 2007-10-12)
		Lavish amenities include a waterfront pool, luxurious spa, feng shui meditation garden, state-of-the-art gym and tennis and sand volleyball courts.
		Panoramic vistas of downtown Miami, Biscayne Bay, and the Atlantic Ocean can be enjoyed from private balconies.
		Luxurious amenities, strategic waterfront location and prices for prime units starting at the low $300,000, make it one of the best buy on South Beach.
	www.miamirealestatetrends.com /Pages/Waverly.aspx (515 words)

	Waverly Condo in Miami Beach - Apartments For Sale and Building Reviews
		Waverly Condo in Miami Beach - Apartments For Sale and Building Reviews
		Miami Beach 411 : Real Estate : Buildings (R-Z) : Search results for Waverly in Miami Beach, FL.
		esigned by architect Arquitectonica, Waverly is a 35-story high-rise that overlooks Biscayne bay, downtown Miami and Port of Miami.
	www.miamibeach411.com /real_estate/condo-the-waverly.htm (334 words)

	Waverly Vacation Rentals - Condo and Villa Accommodations in Florida
		Waverly Vacation Rentals - Condo and Villa Accommodations in Florida
		Rent a vacation rental home at Waverly, Florida, United States.
		Waverly is surrounded by lakes of all sizes and many golf courses.
	www.ownerdirect.com /accommodations/waverly.htm (173 words)

	A Closer Look At (Site not responding. Last check: 2007-10-12)
		All operations are performed from the Florida office located outside Winter Haven and near Cypress Gardens.
		Formed consolidation in 1972 between the Highland Crate Cooperative and the Exchange Supply and Service Cooperative, HESCO operated primarily as a corrugated container broker in Tampa for its member organizations.
		Shipments from the warehouse represent about 20 percent of total sales, handled by a fleet of seven trucks on regular schedule to member sites in Florida.
	www.rurdev.usda.gov /rbs/pub/dec99/closer.htm (470 words)

	Waverly, Florida (FL) Detailed Profile - relocation, real estate, travel, jobs, hotels, hospitals, schools, crime, news
		Waverly, Florida (FL) Detailed Profile - relocation, real estate, travel, jobs, hotels, hospitals, schools, crime, news
		Back to Florida, FL smaller cities, FL small cities, All Cities.
		Waverly-area historical tornado activity is above Florida state average.
	www.city-data.com /city/Waverly-Florida.html (1083 words)

	Florida Waverly Toe Rings - Toe Rings - Body Jewelry - Toe Ring Sale (Site not responding. Last check: 2007-10-12)
		Toerings.com has a large range of custom fit, comfortable toe rings to best show your individual style Read more about florida waverly toe rings by visiting our home page or call 719-488-0266.
		Feel free to read more about florida waverly toe rings and see how you can benefit.
		Visit our home page for more on florida waverly toe rings and more.
	www.toerings.com /florida-waverly-toe-rings.html (711 words)

	Waverly home builder - Florida - Polk County home building guide (Site not responding. Last check: 2007-10-12)
		If you have a home building project in Waverly Florida or if you are planning a major home improvement project then we recommend you this Florida home builder referral program.
		Simply filling this building form you will receive within 48 hours free construction estimates from Waverly prescreened homebuilders interested by your residential construction project.
		There is no better and faster service to get free Florida home builders cost quotes for your construction project!
	www.home-building-directory.com /usa/florida/polk-county/waverly (95 words)

	Waverly Hundred Homeowner's Association, Davie, Florida
		Waverly Hundred is a community of 293 homes located in southwest Broward County Florida.
		Waverly Hundred is part of a larger development called Ivanhoe.
		Ivanhoe is generally located between Sheridan Street and Griffin Road, on either side of I-75.
	www.waverlyhundred.org (72 words)

	Waverly - South Beach, FL - Waverly Miami Beach
		Waverly - South Beach, FL - Waverly Miami Beach
		Designed by the world-renowned firm Arquitectonica, The Waverly at South Beach is a 399-unit high-rise condominium, comprised of two interconnected residential towers of 29 and 35 stories.
		Waverly sits on the bright blue waters of Biscayne Bay and is just steps from Lincoln Road, Barton G restaurant and a number of other hot spots.
	www.peterfragos.com /miamibeach_waverly.shtml (109 words)

	The Waverly Property Options in Miami Beach, FL (Site not responding. Last check: 2007-10-12)
		The Waverly Property Options in Miami Beach, FL The Waverly - Property Options
		This modern high rise boasts spacious apartments with abundant closet space, large windows and bright living areas.
		Situated on nearly three acres of prime South Beach property, featuring 275 feet of waterfront, The Waverly offers residents a myriad of exclusive features, conveniences and lifestyle luxuries.
	www.rent.com /rentals/florida/miami-and-vicinity/miami-beach/430718 (131 words)

Try your search on: Qwika (all wikis)